Structure of PDB 3c01 Chain F Binding Site BS01

Receptor Information

>3c01 Chain F (length=87) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PTHITIGIYFKPELMPIPMISVYETNQRALAVRAYAEKVGVPVIVDIKLA
RSLFKTHRRYDLVSLEEIDEVLRLLVWLEEVENAGKD

Ligand information

>3c01 Chain B (length=20) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

EILSEQVKSDIENSRLIVAN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3c01 Structural analysis of the essential self-cleaving type III secretion proteins EscU and SpaS.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	H261 I262 T263 I264 G265 I266 Y267 S279 V280 R286 Y293 P300 I302 V303 D304 Y318 L336 E337 E340
Binding residue (residue number reindexed from 1)	H3 I4 T5 I6 G7 I8 Y9 S21 V22 R28 Y35 P42 I44 V45 D46 Y60 L78 E79 E82

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0009306	protein secretion

	Cellular Component
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3c01, PDBe:3c01, PDBj:3c01
PDBsum	3c01
PubMed	18451864
UniProt	P40702\|SPAS_SALTY Surface presentation of antigens protein SpaS (Gene Name=spaS)

[Back to BioLiP]