Structure of PDB 3aae Chain F Binding Site BS01

Receptor Information
>3aae Chain F (length=250) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARD
KVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANN
AFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIH
VVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDET
VSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDN
Ligand information
>3aae Chain Z (length=28) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ISELPSEEGRRLEHFTKLRPKRNKKQQP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3aae Two distinct mechanisms for the regulation of actin capping protein-competitive or allosteric inhibitions
Resolution3.3 Å
Binding residue
(original residue number in PDB)		D7 L10 D11 R14 R15 E37 S41 S42 D44 D63 Y64 R66 D67 D85 W122 V153 T170 Q196
Binding residue
(residue number reindexed from 1)		D5 L8 D9 R12 R13 E35 S39 S40 D42 D61 Y62 R64 D65 D83 W120 V151 T168 Q194
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0051015 actin filament binding
Biological Process
GO:0000902 cell morphogenesis
GO:0007010 cytoskeleton organization
GO:0008154 actin polymerization or depolymerization
GO:0010591 regulation of lamellipodium assembly
GO:0022604 regulation of cell morphogenesis
GO:0030030 cell projection organization
GO:0030032 lamellipodium assembly
GO:0030036 actin cytoskeleton organization
GO:0051016 barbed-end actin filament capping
GO:0051490 negative regulation of filopodium assembly
GO:0051693 actin filament capping
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005903 brush border
GO:0008290 F-actin capping protein complex
GO:0014069 postsynaptic density
GO:0016020 membrane
GO:0030018 Z disc
GO:0030027 lamellipodium
GO:0030863 cortical cytoskeleton
GO:0031674 I band
GO:0032279 asymmetric synapse
GO:0071203 WASH complex
GO:0098685 Schaffer collateral - CA1 synapse
GO:0098686 hippocampal mossy fiber to CA3 synapse
GO:0120212 sperm head-tail coupling apparatus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3aae, PDBe:3aae, PDBj:3aae
PDBsum3aae
PubMed
UniProtP14315|CAPZB_CHICK F-actin-capping protein subunit beta isoforms 1 and 2 (Gene Name=CAPZB)

[Back to BioLiP]