Structure of PDB 2zt9 Chain F Binding Site BS01

Receptor Information
>2zt9 Chain F (length=32) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSGELLNAALLSFGLIFVGWALGALLLKIQGA
Ligand information
>2zt9 Chain H (length=29) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MAILTLGWVSLLVVFTWSIAMVVWGRNGL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2zt9 Structure-Function, Stability, and Chemical Modification of the Cyanobacterial Cytochrome b6f Complex from Nostoc sp. PCC 7120
Resolution3.0 Å
Binding residue
(original residue number in PDB)		L15 G19 G23 L26 L27
Binding residue
(residue number reindexed from 1)		L15 G19 G23 L26 L27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0009512 cytochrome b6f complex
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2zt9, PDBe:2zt9, PDBj:2zt9
PDBsum2zt9
PubMed19189962
UniProtP0A3Y1|PETM_NOSS1 Cytochrome b6-f complex subunit 7 (Gene Name=petM)

[Back to BioLiP]