Structure of PDB 2y0n Chain F Binding Site BS01

Receptor Information
>2y0n Chain F (length=36) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VTSFFPESLLITPFLPVVAFGRPLPKLAPQNFELPW
Ligand information
>2y0n Chain G (length=29) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VTSFFPITPFLPVVAFGRPLPKLAPQNFE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2y0n Structural Basis for Mof and Msl3 Recruitment Into the Dosage Compensation Complex by Msl1.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
F556 F557 L566 I568 P570 F577 G578
Binding residue
(residue number reindexed from 1)
F4 F5 L9 I11 P13 F20 G21
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:2y0n, PDBe:2y0n, PDBj:2y0n
PDBsum2y0n
PubMed21217699
UniProtQ6PDM1|MSL1_MOUSE Male-specific lethal 1 homolog (Gene Name=Msl1)

[Back to BioLiP]