Structure of PDB 2rl0 Chain F Binding Site BS01

Receptor Information
>2rl0 Chain F (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCND
QDTRTSYRIGDTWSKKDRGNLLQCICTGNGRGEWKCER
Ligand information
>2rl0 Chain H (length=17) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QVTTESNLVEFDEESTK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2rl0 Crystal structures of fibronectin-binding sites from Staphylococcus aureus FnBPA in complex with fibronectin domains
Resolution2.0 Å
Binding residue
(original residue number in PDB)		C155 F156 H158 Y174 S189 G190 R191 I192 T193 C194 T195 S196 R197 R234 G235 E236 W237 K238 C239
Binding residue
(residue number reindexed from 1)		C3 F4 H6 Y22 S37 G38 R39 I40 T41 C42 T43 S44 R45 R81 G82 E83 W84 K85 C86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005576 extracellular region

View graph for
Cellular Component
External links
PDB RCSB:2rl0, PDBe:2rl0, PDBj:2rl0
PDBsum2rl0
PubMed18713862
UniProtP02751|FINC_HUMAN Fibronectin (Gene Name=FN1)

[Back to BioLiP]