Structure of PDB 2rkz Chain F Binding Site BS01

Receptor Information
>2rkz Chain F (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHE
GGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCKPI
Ligand information
>2rkz Chain R (length=19) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ETLTGQYDKNLVTTVEEEY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2rkz Crystal structures of fibronectin-binding sites from Staphylococcus aureus FnBPA in complex with fibronectin domains
Resolution2.0 Å
Binding residue
(original residue number in PDB)		R83 R99 G100 R101 I102 S103 C104 T105 I106 R109 H111 Y132 K143 G144 E145 W146 T147 C148 P150
Binding residue
(residue number reindexed from 1)		R21 R37 G38 R39 I40 S41 C42 T43 I44 R47 H49 Y70 K81 G82 E83 W84 T85 C86 P88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005576 extracellular region

View graph for
Cellular Component
External links
PDB RCSB:2rkz, PDBe:2rkz, PDBj:2rkz
PDBsum2rkz
PubMed18713862
UniProtP02751|FINC_HUMAN Fibronectin (Gene Name=FN1)

[Back to BioLiP]