Structure of PDB 2qqp Chain F Binding Site BS01

Receptor Information
>2qqp Chain F (length=67) Species: 1289469 (Providence virus Helicoverpa zea /United States/vFLM1/-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FAGTVSALASIGLGLLGKSSATPSVIKGIAQQAVGAVQANPGILEGAVKA
IGSVGARLVGSIKARRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qqp Evolution in action: N and C termini of subunits in related T = 4 viruses exchange roles as molecular switches.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		K605 R613 R621
Binding residue
(residue number reindexed from 1)		K49 R57 R65
Enzymatic activity
Enzyme Commision number ?
External links