Structure of PDB 2mf1 Chain F Binding Site BS01

Receptor Information
>2mf1 Chain F (length=59) Species: 220664 (Pseudomonas protegens Pf-5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQR
IQAGLTAPD
Ligand information
>2mf1 Chain G (length=72) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugucgacggauagacacagccaucaaggacgauggucaggacaucgcagg
aagcgauucaucaggacgauga
<<<<........>>>>..<<<<<<......>>>>>>.......<<<<...
..>>>>.<<<<<.....>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mf1 Structural basis of the non-coding RNA RsmZ acting as a protein sponge.
ResolutionN/A
Binding residue
(original residue number in PDB)		M1 L2 I3 T5 K7
Binding residue
(residue number reindexed from 1)		M1 L2 I3 T5 K7
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0048027 mRNA 5'-UTR binding
Biological Process
GO:0006109 regulation of carbohydrate metabolic process
GO:0006402 mRNA catabolic process
GO:0006417 regulation of translation
GO:0045947 negative regulation of translational initiation
GO:0045948 positive regulation of translational initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2mf1, PDBe:2mf1, PDBj:2mf1
PDBsum2mf1
PubMed24828038
UniProtP0DPC3|CSRA1_PSEPH Translational regulator CsrA1 (Gene Name=csrA1)

[Back to BioLiP]