Structure of PDB 2ffd Chain F Binding Site BS01

Receptor Information
>2ffd Chain F (length=285) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANK
GAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWI
QYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTST
ADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNG
MQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKAST
PNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ffd The structure of fibrinogen fragment D with the 'A' knob peptide GPRVVE.
Resolution2.89 Å
Binding residue
(original residue number in PDB)
F295 D301 F322 Q329 D330 K338 C339 H340 Y363 D364
Binding residue
(residue number reindexed from 1)
F186 D192 F213 Q220 D221 K229 C230 H231 Y254 D255
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005102 signaling receptor binding
Biological Process
GO:0007596 blood coagulation
GO:0030168 platelet activation
GO:0051258 protein polymerization
Cellular Component
GO:0005577 fibrinogen complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2ffd, PDBe:2ffd, PDBj:2ffd
PDBsum2ffd
PubMed16689770
UniProtP02679|FIBG_HUMAN Fibrinogen gamma chain (Gene Name=FGG)

[Back to BioLiP]