Structure of PDB 2e76 Chain F Binding Site BS01

Receptor Information
>2e76 Chain F (length=32) Species: 83541 (Mastigocladus laminosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTEEMLYAALLSFGLIFVGWGLGVLLLKIQGA
Ligand information
>2e76 Chain H (length=29) Species: 83541 (Mastigocladus laminosus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MEIDVLGWVALLVVFTWSIAMVVWGRNGL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2e76 Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
Resolution3.41 Å
Binding residue
(original residue number in PDB)		I16 G19 L26 L27
Binding residue
(residue number reindexed from 1)		I16 G19 L26 L27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0009512 cytochrome b6f complex
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2e76, PDBe:2e76, PDBj:2e76
PDBsum2e76
PubMed17498743
UniProtP83796|PETM_MASLA Cytochrome b6-f complex subunit 7 (Gene Name=petM)

[Back to BioLiP]