Structure of PDB 2avu Chain F Binding Site BS01

Receptor Information

>2avu Chain F (length=156) Species: 562 (Escherichia coli)

SIVQEARDIQLAMELITLGARLQMLESETQLSRGRLIKLYKELRGSPPPK
GMLPFSTDWFMTWEQNVHASMFCNAWQFLLKTGLCNGVDAVIKAYRLYLE
QCPQAEEGPLLALTRAWTLVRFVESGLLQLSSCNCCGGNFITHAHQPVGS
FACSLC

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 2avu Chain F Residue 300

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2avu Structure of the Escherichia coli FlhDC Complex, a Prokaryotic Heteromeric Regulator of Transcription.
• Resolution: 3.0 Å
• Binding residue (original residue number in PDB): C137 C140 C157 C160
• Binding residue (residue number reindexed from 1): C133 C136 C153 C156
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006351 DNA-templated transcription
• GO:0006355 regulation of DNA-templated transcription
• GO:0044781 bacterial-type flagellum organization
• GO:0045893 positive regulation of DNA-templated transcription
• GO:1902208 regulation of bacterial-type flagellum assembly
• GO:1902210 positive regulation of bacterial-type flagellum assembly

Cellular Component

• GO:0005667 transcription regulator complex
• GO:0005737 cytoplasm

External links

• PDB: RCSB:2avu, PDBe:2avu, PDBj:2avu
• PDBsum: 2avu
• PubMed: 16337229
• UniProt: P0ABY7|FLHC_ECOLI Flagellar transcriptional regulator FlhC (Gene Name=flhC)