Structure of PDB 1zg1 Chain F Binding Site BS01

Receptor Information
>1zg1 Chain F (length=66) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RDVNQLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKL
KSRVEAAVWVHQERIF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zg1 Primary and Secondary Modes of DNA Recognition by the NarL Two-Component Response Regulator.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		T157 R159 I182 T183 S185 T186 V189 H190
Binding residue
(residue number reindexed from 1)		T7 R9 I32 T33 S35 T36 V39 H40
Binding affinityPDBbind-CN: Kd=0.45uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1zg1, PDBe:1zg1, PDBj:1zg1
PDBsum1zg1
PubMed16262254
UniProtP0AF28|NARL_ECOLI Nitrate/nitrite response regulator protein NarL (Gene Name=narL)

[Back to BioLiP]