Structure of PDB 1yfj Chain F Binding Site BS01

Receptor Information
>1yfj Chain F (length=243) Species: 10665 (Tequatrovirus T4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLGAIAYTGNKQSLLPELKSHFPKYNRFVDLFCGGLSVSLNVNGPVLAND
IQEPIIEMYKRLINVSWDDVLKVIKQYKLSKTSKEEFLKLREDYNKTRDP
LLLYVLHFHGFSNMIRINDKGNFTTPFGKRTINKNSEKRFNHFKQNCDKI
IFSSLHFKDVKILDGDFVYVDPPYLITVADYNKFWSEDEEKDLLNLLDSL
NDRGIKFGLSNVLEHHGKENTLLKEWSKKYNVKHLTDEVYIFN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1yfj Transition from Nonspecific to Specific DNA Interactions along the Substrate-Recognition Pathway of Dam Methyltransferase.
Resolution2.69 Å
Binding residue
(original residue number in PDB)
R91 F111 S112 R116 N118 P126 G128 R130
Binding residue
(residue number reindexed from 1)
R91 F111 S112 R116 N118 P126 G128 R130
Enzymatic activity
Enzyme Commision number 2.1.1.72: site-specific DNA-methyltransferase (adenine-specific).
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0008168 methyltransferase activity
GO:0009007 site-specific DNA-methyltransferase (adenine-specific) activity
GO:0009008 DNA-methyltransferase activity
GO:0043565 sequence-specific DNA binding
GO:1904047 S-adenosyl-L-methionine binding
Biological Process
GO:0006260 DNA replication
GO:0006298 mismatch repair
GO:0009307 DNA restriction-modification system
GO:0019049 virus-mediated perturbation of host defense response
GO:0032259 methylation
GO:0052170 symbiont-mediated suppression of host innate immune response
GO:0099018 symbiont-mediated evasion of host restriction-modification system

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1yfj, PDBe:1yfj, PDBj:1yfj
PDBsum1yfj
PubMed15882618
UniProtP04392|DMA_BPT4 DNA adenine methylase (Gene Name=DAM)

[Back to BioLiP]