Structure of PDB 1xb0 Chain F Binding Site BS01

Receptor Information
>1xb0 Chain F (length=103) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TNLPRNPSMTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHC
GGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHLTRSLEGALV
QTT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1xb0 The BIR domain of IAP-like protein 2 is conformationally unstable: implications for caspase inhibition
Resolution2.2 Å
Binding residue
(original residue number in PDB)
G306 L307 A308 W310 E314 Q319 W323
Binding residue
(residue number reindexed from 1)
G53 L54 A55 W57 E61 Q66 W70
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1xb0, PDBe:1xb0, PDBj:1xb0
PDBsum1xb0
PubMed15485395
UniProtQ96P09|BIRC8_HUMAN Baculoviral IAP repeat-containing protein 8 (Gene Name=BIRC8)

[Back to BioLiP]