Structure of PDB 1wav Chain F Binding Site BS01

Receptor Information

>1wav Chain F (length=30) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Ligand information

>1wav Chain A (length=21) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GIVEQCCTSICSLYQLENYCN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1wav Molecular replacement study on form-B monoclinic crystal of insulin.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	F1 V2
Binding residue (residue number reindexed from 1)	F1 V2

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005179	hormone activity

	Cellular Component
GO:0005576	extracellular region

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:1wav, PDBe:1wav, PDBj:1wav
PDBsum	1wav
PubMed	8760462
UniProt	P01315\|INS_PIG Insulin (Gene Name=INS)

[Back to BioLiP]