Structure of PDB 1vtl Chain F Binding Site BS01

Receptor Information

>1vtl Chain F (length=186) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIM
RIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKD
FKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVL
LIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI

Ligand information

>1vtl Chain C (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gctataaaagggca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1vtl Co-Crystal Structure of TBP Recognizing the Minor Groove of a TATA Element
Resolution	2.25 Å
Binding residue (original residue number in PDB)	V29 F57 F74 S76 V80 Q116 N117 L147 F148 R154 V161 L163 T173
Binding residue (residue number reindexed from 1)	V17 F45 F62 S64 V68 Q104 N105 L135 F136 R142 V149 L151 T161

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding

	Biological Process
GO:0006352	DNA-templated transcription initiation

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1vtl, PDBe:1vtl, PDBj:1vtl
PDBsum	1vtl
PubMed	8413605
UniProt	P28147\|TBP1_ARATH TATA-box-binding protein 1 (Gene Name=TBP1)

[Back to BioLiP]