Structure of PDB 1vf5 Chain F Binding Site BS01

Receptor Information
>1vf5 Chain F (length=33) Species: 83541 (Mastigocladus laminosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTEEMLYAALLSFGLIFVGWGLGVLLLKIQGAE
Ligand information
>1vf5 Chain G (length=23) Species: 83541 (Mastigocladus laminosus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LVLGLVFATLGGLFYAAYQQYKR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1vf5 Structure of the Cytochrome B6F Complex of Oxygenic Photosynthesis: Tuning the Cavity
Resolution3.0 Å
Binding residue
(original residue number in PDB)		L15 G19 W20 G23 L26 L27
Binding residue
(residue number reindexed from 1)		L15 G19 W20 G23 L26 L27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0009512 cytochrome b6f complex
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1vf5, PDBe:1vf5, PDBj:1vf5
PDBsum1vf5
PubMed14526088
UniProtP83796|PETM_MASLA Cytochrome b6-f complex subunit 7 (Gene Name=petM)

[Back to BioLiP]