Structure of PDB 1toc Chain F Binding Site BS01

Receptor Information
>1toc Chain F (length=259) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDI
ALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTT
SVAEVQPSVLQVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDA
CEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWI
QKVIDRLGS
Ligand information
>1toc Chain E (length=28) Species: 9913 (Bos taurus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ADCGLRPLFEKKQVQDQTEKELFESYIE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1toc The ornithodorin-thrombin crystal structure, a key to the TAP enigma?
Resolution3.1 Å
Binding residue
(original residue number in PDB)
E23 L26 P28 W29 H119 P120 V121 C122 H131 F134 K135 G136 R137 N159 K202 P204 R206 W207
Binding residue
(residue number reindexed from 1)
E8 L11 P13 W14 H116 P117 V118 C119 H131 F134 K135 G136 R137 N164 K212 P214 R218 W219
Enzymatic activity
Catalytic site (original residue number in PDB) C42 N98
Catalytic site (residue number reindexed from 1) C28 N95
Enzyme Commision number 3.4.21.5: thrombin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005509 calcium ion binding
Biological Process
GO:0006508 proteolysis
GO:0007596 blood coagulation

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1toc, PDBe:1toc, PDBj:1toc
PDBsum1toc
PubMed8947023
UniProtP00735|THRB_BOVIN Prothrombin (Gene Name=F2)

[Back to BioLiP]