Structure of PDB 1re3 Chain F Binding Site BS01

Receptor Information

>1re3 Chain F (length=291) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKD
CQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSV
DFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELED
WNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDK
FFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGG
TYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT

Ligand information

>1re3 Chain H (length=4) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GHRP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1re3 BbetaGlu397 and BbetaAsp398 but not BbetaAsp432 are required for "B:b" interactions.
Resolution	2.45 Å
Binding residue (original residue number in PDB)	F295 D297 D301 T305 F322 Q329 D330 K338 C339 H340 Y363 D364
Binding residue (residue number reindexed from 1)	F193 D195 D199 T203 F220 Q227 D228 K236 C237 H238 Y261 D262

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005102	signaling receptor binding

	Biological Process
GO:0007596	blood coagulation
GO:0030168	platelet activation
GO:0051258	protein polymerization

	Cellular Component
GO:0005577	fibrinogen complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1re3, PDBe:1re3, PDBj:1re3
PDBsum	1re3
PubMed	14992584
UniProt	P02679\|FIBG_HUMAN Fibrinogen gamma chain (Gene Name=FGG)

[Back to BioLiP]