Structure of PDB 1qzh Chain F Binding Site BS01

Receptor Information

>1qzh Chain F (length=170) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VIDSLQLNELLNAGEYKIGELTFQSIRSSQELQKKNTIVNLFGIVKDFTP
SRQSLHGTKDWVTTVYLWDPTCDTSSIGLQIHLFSKQGNDLPVIKQVGQP
LLLHQITLRSYRDRTQGLSKDQFRYALWPDFSSNSKDTLCPQPMPRLMKT
GDKEEQFALLLNKIWDEQTN

Ligand information

>1qzh Chain H (length=6) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggttac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1qzh DNA self-recognition in the structure of Pot1 bound to telomeric single-stranded DNA
Resolution	2.4 Å
Binding residue (original residue number in PDB)	G61 T62
Binding residue (residue number reindexed from 1)	G57 T58

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0043047	single-stranded telomeric DNA binding

	Biological Process
GO:0000723	telomere maintenance

	Cellular Component
GO:0000781	chromosome, telomeric region

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1qzh, PDBe:1qzh, PDBj:1qzh
PDBsum	1qzh
PubMed	14614509
UniProt	O13988\|POT1_SCHPO Protection of telomeres protein 1 (Gene Name=pot1)

[Back to BioLiP]