Structure of PDB 1qiz Chain F Binding Site BS01

Receptor Information
>1qiz Chain F (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQYLCGSHLVEALYLVCGERGFFYTPKT
Ligand information
>1qiz Chain A (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1qiz Structural Consequences of the B5 Histidine --> Tyrosine Mutation in Human Insulin Characterized by X-Ray Crystallography and Conformational Analysis.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		F1 V2
Binding residue
(residue number reindexed from 1)		F1 V2
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1qiz, PDBe:1qiz, PDBj:1qiz
PDBsum1qiz
PubMed10508408
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]