Structure of PDB 1q3u Chain F Binding Site BS01

Receptor Information
>1q3u Chain F (length=322) Species: 10678 (Punavirus P1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPE
DVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRR
IRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAFLGIAYN
TLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTK
LVERWISVSGVADDPNNYLFCRVRKNGVAAPSATSQLSTRALEGIFEATH
RLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVN
IVMNYIRNLDSETGAMVRLLED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1q3u Crystal structure of a wild-type Cre recombinase-loxP synapse reveals a novel spacer conformation suggesting an alternative mechanism for DNA cleavage activation
Resolution2.9 Å
Binding residue
(original residue number in PDB)		M44 R50 R81 L83 A84 K86 T87 R118 K122 A131 K132 R159 R173 K201 R241 V242 K244 S257 R259 R282 Y283 R292 W315 T316 N317 I320 Y324
Binding residue
(residue number reindexed from 1)		M25 R31 R62 L64 A65 K67 T68 R99 K103 A112 K113 R140 R154 K182 R222 V223 K225 S238 R240 R263 Y264 R273 W296 T297 N298 I301 Y305
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006310 DNA recombination
GO:0015074 DNA integration

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1q3u, PDBe:1q3u, PDBj:1q3u
PDBsum1q3u
PubMed12954782
UniProtP06956|RECR_BPP1 Recombinase cre (Gene Name=cre)

[Back to BioLiP]