Structure of PDB 1n86 Chain F Binding Site BS01

Receptor Information
>1n86 Chain F (length=295) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIH
DITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQK
RLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYAL
RVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFG
DDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNG
VYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1n86 The crystal structure of fragment double-D from cross-linked lamprey fibrin reveals isopeptide linkages across an unexpected D-D interface.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		F295 D301 T305 F322 Q329 K338 C339 H340 Y363 D364
Binding residue
(residue number reindexed from 1)		F199 D205 T209 F226 Q233 K242 C243 H244 Y267 D268
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005102 signaling receptor binding
Biological Process
GO:0007596 blood coagulation
GO:0030168 platelet activation
GO:0051258 protein polymerization
Cellular Component
GO:0005577 fibrinogen complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1n86, PDBe:1n86, PDBj:1n86
PDBsum1n86
PubMed12501189
UniProtP02679|FIBG_HUMAN Fibrinogen gamma chain (Gene Name=FGG)

[Back to BioLiP]