Structure of PDB 1mey Chain F Binding Site BS01

Receptor Information
>1mey Chain F (length=84) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEKPYKCPECGKSFSQSSNLQKHQRTHTGEKPYKCPECGKSFSQSSDLQK
HQRTHTGEKPYKCPECGKSFSRSDHLSRHQRTHQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mey A 2.2 A Resolution Crystal Structure of a Designed Zinc Finger Protein Bound to DNA
Resolution2.2 Å
Binding residue
(original residue number in PDB)		K12 F14 Q16 N19 K22 H23 T26 Q44 D47 H51 T54 R72 H75 R78 H79 T82
Binding residue
(residue number reindexed from 1)		K12 F14 Q16 N19 K22 H23 T26 Q44 D47 H51 T54 R72 H75 R78 H79 T82
External links