Structure of PDB 1m5k Chain F Binding Site BS01

Receptor Information
>1m5k Chain F (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQA
FVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Ligand information
>1m5k Chain E (length=92) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggagagagaagucaaccagagaaacacaccaacccauugcacuccggguu
ggugguauauuaccugguacgggggaaacuucgugguggccg
..............<<<<<....<..<<<<<<<<<..........>>>>>
>>>>.....>...>>>>><<<<<<....>>>>>>........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1m5k Transition state stabilization by a catalytic RNA
Resolution2.4 Å
Binding residue
(original residue number in PDB)		Y13 N15 N16 E19 S48 L49 K50 M51 R52 Q54 F56 K80 Q85 K88 D90 S91 D92
Binding residue
(residue number reindexed from 1)		Y8 N10 N11 E14 S43 L44 K45 M46 R47 Q49 F51 K75 Q80 K83 D85 S86 D87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:1m5k, PDBe:1m5k, PDBj:1m5k
PDBsum1m5k
PubMed11298439
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]