Structure of PDB 1m1j Chain F Binding Site BS01

Receptor Information

>1m1j Chain F (length=389) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RENCCILDERFGSYCPTTCGIADFFNKYRLTTDGELLEIEGLLQQATNST
GSIEYLIQHIKTIYPSEKQTLPQSIEQLTQKSKKIIEEIIRYENTILAHE
NTIQQLTDMHIMNSNKITQLKQKIAQLESHCQEPCKDTAEIQETTGRDCQ
DIANKGARKSGLYFIKPQKAKQSFLVYCEIDTYGNGWTVLQRRLDGSEDF
RRNWVQYKEGFGHLSPDDTTEFWLGNEKIHLITTQSTLPYALRIELEDWS
GKKGTADYAVFKVGTEEDKYRLTYAYFIGGEAGDAFDGFNFGDDPSDKSY
TYHNGMRFSTFDNDNDNFEGNCAEQDGSGWWMNRCHAGHLNGPYYIGGVY
SRDTGTNSYDNGIIWATWRDRWYSMKKTTMKIIPFNRLS

Ligand information

>1m1j Chain H (length=4) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GPRP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1m1j Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
Resolution	2.7 Å
Binding residue (original residue number in PDB)	F295 D301 F322 Q329 R338 C339 H340 Y363 D364
Binding residue (residue number reindexed from 1)	F291 D297 F318 Q325 R334 C335 H336 Y359 D360

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005102	signaling receptor binding
GO:0030674	protein-macromolecule adaptor activity
GO:0046872	metal ion binding

	Biological Process
GO:0007596	blood coagulation
GO:0030168	platelet activation
GO:0051258	protein polymerization

	Cellular Component
GO:0005576	extracellular region
GO:0005577	fibrinogen complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1m1j, PDBe:1m1j, PDBj:1m1j
PDBsum	1m1j
PubMed	11601975
UniProt	O93568

[Back to BioLiP]