Structure of PDB 1m06 Chain F Binding Site BS01

Receptor Information

>1m06 Chain F (length=422) Species: 10849 (Escherichia phage alpha3) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

REIVDLSHLAFDCGMLGRLKTVSWTPVIAGDSFELDAVGALRLSPLRRGL
AIDSKVDFFTFYIPHRHVYGDQWIQFMRDGVNAQPLPSVTCNRYPDHAGY
VGTIVPANNRIPKFLHQSYLNIYNNYFRAPWMPERTEANPSNLNEDDARY
GFRCCHLKNIWSAPLPPETKLAEEMGIESNSIDIMGLQAAYAQLHTEQER
TYFMQRYRDVISSFGGSTSYDADNRPLLVMHTDFWASGYDVDGTDQSSLG
QFSGRVQQTFKHSVPRFFVPEHGVMMTLALIRFPPISPLEHHYLAGKSQL
TYTDLAGDPALIGNLPPREISYRDLFRDGRSGIKIKVAESIWYRTHPDYV
NFKYHDLHGFPFLDDAPGTSTGDNLQEAILVRHQDYDACFQSQQLLQWNK
QARYNVSVYRHMPTVRDSIMTS

Ligand information

>1m06 Chain J (length=24) Species: 10849 (Escherichia phage alpha3) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

MKKARRSPSRRKGARLWYVGGSQF

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1m06 Structural Studies of Bacteriophage alpha3 Assembly
Resolution	3.5 Å
Binding residue (original residue number in PDB)	I61 D62 F68 Y135 F136 A138 P139 C164 K167 N168 I169 A172 Y211 F212 Q214 R215 W244 R291 P293 I350 D357
Binding residue (residue number reindexed from 1)	I52 D53 F59 Y126 F127 A129 P130 C155 K158 N159 I160 A163 Y202 F203 Q205 R206 W235 R282 P284 I341 D348

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005198	structural molecule activity

	Biological Process
GO:0046718	symbiont entry into host cell

	Cellular Component
GO:0039615	T=1 icosahedral viral capsid

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1m06, PDBe:1m06, PDBj:1m06
PDBsum	1m06
PubMed	12473449
UniProt	P08767\|CAPSD_BPAL3 Capsid protein F (Gene Name=F)

[Back to BioLiP]