Structure of PDB 1iu3 Chain F Binding Site BS01

Receptor Information
>1iu3 Chain F (length=115) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLGSAMRELLLSDEYAEQKRAVNRFMLLLSTLYSLDAQAFAEATESLHGR
TRVYFAADEQTLLKNGNQTKPKHVPGTPYWVITNTNTGRKCSMIEHIMQS
MQFPAELIEKVCGTI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1iu3 Structural and biochemical analyses of hemimethylated DNA binding by the SeqA protein.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R21 A22 V23 N87 T88
Binding residue
(residue number reindexed from 1)		R20 A21 V22 N86 T87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1iu3, PDBe:1iu3, PDBj:1iu3
PDBsum1iu3
PubMed14704346
UniProtP0AFY8|SEQA_ECOLI Negative modulator of initiation of replication (Gene Name=seqA)

[Back to BioLiP]