Structure of PDB 1htm Chain F Binding Site BS01

Receptor Information
>1htm Chain F (length=123) Species: 140147 (uncultured beta proteobacterium UMTRA-608) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKI
DLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEEMGNGCFK
IYHKCDNACIESIRNGTYDHDVY
Ligand information
>1htm Chain E (length=8) Species: 140147 (uncultured beta proteobacterium UMTRA-608) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TATLCLGH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1htm Structure of influenza haemagglutinin at the pH of membrane fusion.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		A96 E97 E103 L110 F119 G136 C137 F138 K139 I140 Y141
Binding residue
(residue number reindexed from 1)		A57 E58 E64 L71 F80 G97 C98 F99 K100 I101 Y102
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046789 host cell surface receptor binding
Biological Process
GO:0019064 fusion of virus membrane with host plasma membrane
Cellular Component
GO:0019031 viral envelope

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1htm, PDBe:1htm, PDBj:1htm
PDBsum1htm
PubMed8072525
UniProtP03437|HEMA_I68A0 Hemagglutinin (Gene Name=HA)

[Back to BioLiP]