Structure of PDB 1hjb Chain F Binding Site BS01

Receptor Information
>1hjb Chain F (length=120) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGN
DENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQV
ATYHRAIKITVDGPREPRRH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hjb Structural Analyses of DNA Recognition by the Aml1/Runx-1 Runt Domain and its Allosteric Control by Cbfbeta
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R80 K83 R135 R174 R177
Binding residue
(residue number reindexed from 1)		R21 K24 R76 R115 R118
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005524 ATP binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1hjb, PDBe:1hjb, PDBj:1hjb
PDBsum1hjb
PubMed11257229
UniProtQ03347|RUNX1_MOUSE Runt-related transcription factor 1 (Gene Name=Runx1)

[Back to BioLiP]