Structure of PDB 1hcq Chain F Binding Site BS01

Receptor Information
>1hcq Chain F (length=71) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGDYMCPATNQCTIDK
NRRKSCQACRLRKCYEVGMMK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hcq The crystal structure of the estrogen receptor DNA-binding domain bound to DNA: how receptors discriminate between their response elements.
Resolution2.4 Å
Binding residue
(original residue number in PDB)
A29 F30 R33 Q60 R63
Binding residue
(residue number reindexed from 1)
A28 F29 R32 Q57 R60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1hcq, PDBe:1hcq, PDBj:1hcq
PDBsum1hcq
PubMed8221895
UniProtP03372|ESR1_HUMAN Estrogen receptor (Gene Name=ESR1)

[Back to BioLiP]