Structure of PDB 1g7b Chain F Binding Site BS01

Receptor Information
>1g7b Chain F (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Ligand information
>1g7b Chain D (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1g7b Phase changes in T(3)R(3)(f) human insulin: temperature or pressure induced?
Resolution1.3 Å
Binding residue
(original residue number in PDB)		C7 G8
Binding residue
(residue number reindexed from 1)		C7 G8
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1g7b, PDBe:1g7b, PDBj:1g7b
PDBsum1g7b
PubMed11468392
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]