Structure of PDB 1g2f Chain F Binding Site BS01

Receptor Information
>1g2f Chain F (length=87) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERPYACPVESCDRRFSQKTNLDTHIRIHTGQKPFQCRICMRNFSQQASLN
AHIRTHTGEKPFACDICGRKFATLHTRTRHTKIHLRQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1g2f Beyond the "recognition code": structures of two Cys2His2 zinc finger/TATA box complexes.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		R214 Q218 N221 H225 R242 Q246 S249 H253 R270 T277 R280 H281 R287
Binding residue
(residue number reindexed from 1)		R13 Q17 N20 H24 R41 Q45 S48 H52 R69 T76 R79 H80 R86
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1g2f, PDBe:1g2f, PDBj:1g2f
PDBsum1g2f
PubMed11587646
UniProtP08046|EGR1_MOUSE Early growth response protein 1 (Gene Name=Egr1)

[Back to BioLiP]