Structure of PDB 1fzg Chain F Binding Site BS01

Receptor Information
>1fzg Chain F (length=285) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIAN
KGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNW
IQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTS
TADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHN
GMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKAS
TPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1fzg Conformational changes in fragments D and double-D from human fibrin(ogen) upon binding the peptide ligand Gly-His-Arg-Pro-amide.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		D297 D301 T305 F322 Q329 K338 C339 H340 Y363 D364
Binding residue
(residue number reindexed from 1)		D189 D193 T197 F214 Q221 K230 C231 H232 Y255 D256
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005102 signaling receptor binding
Biological Process
GO:0007596 blood coagulation
GO:0030168 platelet activation
GO:0051258 protein polymerization
Cellular Component
GO:0005577 fibrinogen complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1fzg, PDBe:1fzg, PDBj:1fzg
PDBsum1fzg
PubMed10074346
UniProtP02679|FIBG_HUMAN Fibrinogen gamma chain (Gene Name=FGG)

[Back to BioLiP]