Structure of PDB 1d00 Chain F Binding Site BS01

Receptor Information
>1d00 Chain F (length=168) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYT
SRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLM
LLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNS
YVRDDAIFIKAIVDLTGL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1d00 The structural basis for the recognition of diverse receptor sequences by TRAF2.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		K429 F447 R448
Binding residue
(residue number reindexed from 1)		K96 F114 R115
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0004842 ubiquitin-protein transferase activity
GO:0005164 tumor necrosis factor receptor binding
Biological Process
GO:0007250 activation of NF-kappaB-inducing kinase activity
GO:0033209 tumor necrosis factor-mediated signaling pathway
GO:0042981 regulation of apoptotic process
GO:0046328 regulation of JNK cascade
GO:0051865 protein autoubiquitination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1d00, PDBe:1d00, PDBj:1d00
PDBsum1d00
PubMed10518213
UniProtQ12933|TRAF2_HUMAN TNF receptor-associated factor 2 (Gene Name=TRAF2)

[Back to BioLiP]