Structure of PDB 1c9b Chain F Binding Site BS01

Receptor Information
>1c9b Chain F (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREP
RTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQN
MVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVS
GKVVLTGAKVRAEIYEAFENIYPILKGFRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1c9b Structural basis of preinitiation complex assembly on human pol II promoters.
Resolution2.65 Å
Binding residue
(original residue number in PDB)		V169 F214 S216 V220 Q256 N257 F288 R294 L303 T313
Binding residue
(residue number reindexed from 1)		V12 F57 S59 V63 Q99 N100 F131 R137 L146 T156
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006352 DNA-templated transcription initiation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1c9b, PDBe:1c9b, PDBj:1c9b
PDBsum1c9b
PubMed10619841
UniProtP20226|TBP_HUMAN TATA-box-binding protein (Gene Name=TBP)

[Back to BioLiP]