Structure of PDB 1aoi Chain F Binding Site BS01

Receptor Information
>1aoi Chain F (length=87) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENV
IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>1aoi Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1aoi Crystal structure of the nucleosome core particle at 2.8 A resolution.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R45 I46 S47 G48 R78 K79 T80
Binding residue
(residue number reindexed from 1)		R30 I31 S32 G33 R63 K64 T65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity

View graph for
Molecular Function
External links
PDB RCSB:1aoi, PDBe:1aoi, PDBj:1aoi
PDBsum1aoi
PubMed9305837
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]