Structure of PDB 1aiy Chain F Binding Site BS01

Receptor Information
>1aiy Chain F (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Ligand information
>1aiy Chain A (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1aiy Solution structures of the R6 human insulin hexamer.
ResolutionN/A
Binding residue
(original residue number in PDB)		F1 V2 H5
Binding residue
(residue number reindexed from 1)		F1 V2 H5
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1aiy, PDBe:1aiy, PDBj:1aiy
PDBsum1aiy
PubMed9235985
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]