Structure of PDB 4v99 Chain Ea Binding Site BS01

Receptor Information
>4v99 Chain Ea (length=189) Species: 652599 (Panicum mosaic virus strain Kansas 109S) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGQGQGWQKLSHEEIILQVNSSTAADTIQTIPIIPRLSVPAGDKPIYSGS
APHLRTIGSAFAIHRWRALSFEWIPSCPTTTPGNLVLRFYPNYSTETPKT
LTDLMDSESLVLVPSLSGKTYRPKIETRGNPPELRNIDATAFSALSDEDK
GDYSVGRLVVGSSKQAVVIQLGLLRMRYSAEMRGATSIS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v99 The crystallographic structure of Panicum Mosaic Virus (PMV).
Resolution2.9 Å
Binding residue
(original residue number in PDB)
G55 W56 K58 S60 R116 E230
Binding residue
(residue number reindexed from 1)
G6 W7 K9 S11 R67 E181
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005198 structural molecule activity
Cellular Component
GO:0019028 viral capsid
GO:0039617 T=3 icosahedral viral capsid

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:4v99, PDBe:4v99, PDBj:4v99
PDBsum4v99
PubMed23123270
UniProtP89036|CAPSD_PMVK Capsid protein (Gene Name=ORF3)

[Back to BioLiP]