Structure of PDB 7aju Chain EH Binding Site BS01

Receptor Information
>7aju Chain EH (length=237) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAKGKS
GVQTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYM
AFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGIL
EDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEE
LSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILTV
Ligand information
>7aju Chain EA (length=22) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaaauuuaaauuuuuuuuuuuu
......................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7aju Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		F80 S81
Binding residue
(residue number reindexed from 1)		F80 S81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030145 manganese ion binding
Biological Process
GO:0000288 nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:0000467 exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000956 nuclear-transcribed mRNA catabolic process
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0006401 RNA catabolic process
GO:0034475 U4 snRNA 3'-end processing
GO:0071034 CUT catabolic process
GO:0071035 nuclear polyadenylation-dependent rRNA catabolic process
GO:0071038 TRAMP-dependent tRNA surveillance pathway
GO:0071051 poly(A)-dependent snoRNA 3'-end processing
Cellular Component
GO:0000176 nuclear exosome (RNase complex)
GO:0000177 cytoplasmic exosome (RNase complex)
GO:0000178 exosome (RNase complex)
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7aju, PDBe:7aju, PDBj:7aju
PDBsum7aju
PubMed33326748
UniProtQ08285|RRP40_YEAST Exosome complex component RRP40 (Gene Name=RRP40)

[Back to BioLiP]