Structure of PDB 8q3e Chain EEE Binding Site BS01

Receptor Information
>8q3e Chain EEE (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>8q3e Chain MMM (length=17) Species: 11963 (Human spumaretrovirus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GGYNLRPRTYQPQRYGG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8q3e Viral peptide conjugates for metal-warhead delivery to chromatin.
Resolution2.174 Å
Binding residue
(original residue number in PDB)		Q125 R129 R134 A135
Binding residue
(residue number reindexed from 1)		Q88 R92 R97 A98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8q3e, PDBe:8q3e, PDBj:8q3e
PDBsum8q3e
PubMed38495982
UniProtP68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]