Structure of PDB 6tba Chain ED Binding Site BS01

Receptor Information
>6tba Chain ED (length=84) Species: 272942 (Rhodobacter capsulatus SB 1003) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDVFAKHAVSLESPAVRHYEITPSDSTDLARRPRALRVQTGGTLVLRDET
GITVTYTVFAGEILPVRPVRVLATGTTATAVGWE
Ligand information
>6tba Chain FD (length=10) Species: 272942 (Rhodobacter capsulatus SB 1003) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IALGLGLGLA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tba Structure and mechanism of DNA delivery of a gene transfer agent.
Resolution4.54 Å
Binding residue
(original residue number in PDB)
P14 A35
Binding residue
(residue number reindexed from 1)
P14 A35
Enzymatic activity
Enzyme Commision number ?
External links