Structure of PDB 7enc Chain EA Binding Site BS01

Receptor Information

>7enc Chain EA (length=179) Species: 9606 (Homo sapiens)

PAALKRLAKYVIRGFYGIEHALALDILIRNSCVKEEDMLELLKFDRKQLR
SVLNNLKGDKFIKCRMRYFINYRTLVNVVKYKLDHMRRRIETDERDSTNR
ASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTEVEEDESAMPKKDAR
TLLARFNEQIEPIYALLRETEDVNLAYEI

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 7enc Chain EA Residue 501

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7enc Structures of the human Mediator and Mediator-bound preinitiation complex.
• Resolution: 4.13 Å
• Binding residue (original residue number in PDB): C129 C132
• Binding residue (residue number reindexed from 1): C105 C108
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0016251 RNA polymerase II general transcription initiation factor activity
• GO:0046872 metal ion binding

Biological Process

• GO:0001113 transcription open complex formation at RNA polymerase II promoter
• GO:0006366 transcription by RNA polymerase II
• GO:0006367 transcription initiation at RNA polymerase II promoter

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005669 transcription factor TFIID complex
• GO:0005673 transcription factor TFIIE complex
• GO:0005829 cytosol

External links

• PDB: RCSB:7enc, PDBe:7enc, PDBj:7enc
• PDBsum: 7enc
• PubMed: 33958484
• UniProt: P29083|T2EA_HUMAN General transcription factor IIE subunit 1 (Gene Name=GTF2E1)