Structure of PDB 9asi Chain E Binding Site BS01

Receptor Information
>9asi Chain E (length=138) Species: 1360 (Lactococcus lactis subsp. lactis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TELKIGNEKVNSTNFGDFAEKAIRGINHKPFVNSKGGEQKITTSKIRGIL
ELVNKVYNRVINTNDVELSENILADIAYIKVKIAYESGREPVVKDFIQRT
AFTAAITDVMNQRTRESFLLFARYVESLIAYFKFYGGK
Ligand information
>9asi Chain T (length=29) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cuucuucagguuggacagcuggugcugcc
.............................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9asi Molecular basis for cA6 synthesis by a type III-A CRISPR-Cas enzyme and its conversion to cA4 production.
Resolution2.79 Å
Binding residue
(original residue number in PDB)
K56 R58 R100 E101 K149
Binding residue
(residue number reindexed from 1)
K45 R47 R89 E90 K138
External links