Structure of PDB 8yhe Chain E Binding Site BS01

Receptor Information
>8yhe Chain E (length=198) Species: 256318 (metagenome) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKTMKKIYVTMKTLSPLYTGEVRREDKEAAQKRVNFPVRKTATNKVLIPF
KGALRSALEIMLKAKGENVCDTGESRARPCGRCVTCSLFGSMGRAGRASV
DFLISNDTKEQIVRESTHLRIERQTKSASDTFKGEEVIEGATFTATITIS
NPQEKDLSLIQSALKFIEENGIGGWLNKGYGRVSFEVKSEDVATDRFL
Ligand information
>8yhe Chain M (length=46) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaaaacucuucucaugcuggauucgaaauuaggugcgcuucgcg
..............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8yhe Structural basis for the activity of the type VII CRISPR-Cas system.
Resolution3.07 Å
Binding residue
(original residue number in PDB)		T20 G21 E22 F37 R40 P50 K52 A54 R56 P80 G91 S92 M93 T118 H119 L120 R121 I122 R124 K127 F133 G175 W176 N178
Binding residue
(residue number reindexed from 1)		T19 G20 E21 F36 R39 P49 K51 A53 R55 P79 G90 S91 M92 T117 H118 L119 R120 I121 R123 K126 F132 G174 W175 N177
External links