Structure of PDB 8xme Chain E Binding Site BS01

Receptor Information
>8xme Chain E (length=198) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TEEELKRLYRIQKTLMQMLRDRGYFIADSELTMTKQQFIRKHGDNMKRED
LVTLKAKRNDNSDQLYIFFPDEAKVGVKTMKMYTNRMKSENVFRAILVVQ
QNLTPFARTCISEISSKFHLEVFQEAEMLVNIKEHVLVPEHQVLTTEEKK
TLLERYTVKETQLPRIQVTDPIARYFGLKRGQVVKIIRPRYVTYRYVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8xme Transcription of the Plant RNA polymerase IV is prone to backtracking
Resolution3.1 Å
Binding residue
(original residue number in PDB)		G78 V79 T106
Binding residue
(residue number reindexed from 1)		G76 V77 T104
Gene Ontology
Cellular Component
GO:0000418 RNA polymerase IV complex
GO:0000428 DNA-directed RNA polymerase complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005665 RNA polymerase II, core complex

View graph for
Cellular Component
External links
PDB RCSB:8xme, PDBe:8xme, PDBj:8xme
PDBsum8xme
PubMed
UniProtO81098|RPB5A_ARATH DNA-directed RNA polymerases II and IV subunit 5A (Gene Name=NRPB5A)

[Back to BioLiP]