Structure of PDB 8xmc Chain E Binding Site BS01

Receptor Information

>8xmc Chain E (length=198) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TEEELKRLYRIQKTLMQMLRDRGYFIADSELTMTKQQFIRKHGDNMKRED
LVTLKAKRNDNSDQLYIFFPDEAKVGVKTMKMYTNRMKSENVFRAILVVQ
QNLTPFARTCISEISSKFHLEVFQEAEMLVNIKEHVLVPEHQVLTTEEKK
TLLERYTVKETQLPRIQVTDPIARYFGLKRGQVVKIIRPRYVTYRYVV

Ligand information

>8xmc Chain N (length=19) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttgtgcttatcggtagagt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8xmc Transcription of the Plant RNA polymerase IV is prone to backtracking
Resolution	3.1 Å
Binding residue (original residue number in PDB)	G78 V79 T106 F108
Binding residue (residue number reindexed from 1)	G76 V77 T104 F106

Gene Ontology

	Cellular Component
GO:0000418	RNA polymerase IV complex
GO:0000428	DNA-directed RNA polymerase complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005665	RNA polymerase II, core complex

View graph for
Cellular Component

External links

PDB	RCSB:8xmc, PDBe:8xmc, PDBj:8xmc
PDBsum	8xmc
PubMed
UniProt	O81098\|RPB5A_ARATH DNA-directed RNA polymerases II and IV subunit 5A (Gene Name=NRPB5A)

[Back to BioLiP]