Structure of PDB 8x6f Chain E Binding Site BS01

Receptor Information
>8x6f Chain E (length=271) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPVRMYLKEIGRVNLLSAQEEIELAKRIEQGDEVAKSRLAEANLRLVVSI
AKRYVGRGMLFLDLIQEGNMGLIKAVEKFDFNKGFKFSTYATWWIRQAIT
RAIADQARTIRIPVHMVETINKLIRVQRQLLQDLGRDPAPEEIGEEMDLP
AEKVREVLKIAQEPVSLETPIGEEDDSHLGDFIEDQEAQSPSDHAAYELL
KEQLEDVLDTLTDREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQI
EAKALRKLRHPSRSKRLKDFM
Ligand information
>8x6f Chain N (length=52) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
attcttgacatacaaaaacttacgagttataattaaatcttgtaagtgac
aa
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8x6f Structural basis of promoter recognition by Staphylococcus aureus RNA polymerase
Resolution3.7 Å
Binding residue
(original residue number in PDB)		R100 L103 L111 N139 R141 L142 S145 K148 K174 K179 F181 K182 S184 T185 Y186 T188 W189 Q193 P209 H211 R342 Q345
Binding residue
(residue number reindexed from 1)		R4 L7 L15 N43 R45 L46 S49 K52 K78 K83 F85 K86 S88 T89 Y90 T92 W93 Q97 P113 H115 R246 Q249
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0010468 regulation of gene expression
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8x6f, PDBe:8x6f, PDBj:8x6f
PDBsum8x6f
PubMed38844782
UniProtP0A0J0|SIGA_STAA8 RNA polymerase sigma factor SigA (Gene Name=sigA)

[Back to BioLiP]