Structure of PDB 8wpk Chain E Binding Site BS01

Receptor Information
>8wpk Chain E (length=57) Species: 10244 (Monkeypox virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDLKVATDNIVKDLKKIITRISAVSTVLEDVQAAGISRQFTSMTKAITTL
SDLVTEG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wpk Structural insights into the assembly and mechanism of monkeypox virus DNA polymerase complex F8-A22-E4-H5
Resolution2.7 Å
Binding residue
(original residue number in PDB)		T180 K184
Binding residue
(residue number reindexed from 1)		T41 K45
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0019031 viral envelope
GO:0030430 host cell cytoplasm
GO:0044423 virion component

View graph for
Cellular Component
External links
PDB RCSB:8wpk, PDBe:8wpk, PDBj:8wpk
PDBsum8wpk
PubMed37995690
UniProtA0A7H0DN82|PG110_MONPV Late transcription elongation factor OPG110 (Gene Name=OPG110)

[Back to BioLiP]