Structure of PDB 8wpf Chain E Binding Site BS01

Receptor Information
>8wpf Chain E (length=57) Species: 10244 (Monkeypox virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDLKVATDNIVKDLKKIITRISAVSTVLEDVQAAGISRQFTSMTKAITTL
SDLVTEG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wpf Structural insights into the assembly and mechanism of monkeypox virus DNA polymerase complex F8-A22-E4-H5
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R177 T180 S181
Binding residue
(residue number reindexed from 1)		R38 T41 S42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0019031 viral envelope
GO:0030430 host cell cytoplasm
GO:0044423 virion component

View graph for
Cellular Component
External links
PDB RCSB:8wpf, PDBe:8wpf, PDBj:8wpf
PDBsum8wpf
PubMed37995690
UniProtA0A7H0DN82|PG110_MONPV Late transcription elongation factor OPG110 (Gene Name=OPG110)

[Back to BioLiP]